Thymosin Beta-4 5mg (TB-500)
The 5mg vial of thymosin beta-4, the 43-residue actin-binding peptide often sold under the name TB-500. Its N-terminal tetrapeptide, Ac-SDKP, is itself studied as a separate bioactive fragment.
Specification
| Quantity per vial | 5mg |
|---|---|
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Molecular formula | C212H350N56O78S |
| Molecular weight | 4963.4 g/mol |
| Stated purity | ≥98% |
| Form | Lyophilised solid |
| Storage | -20°C, sealed, protected from light and moisture |
Research background
Tβ4 is used in in-vitro studies of how cells regulate actin polymerisation during migration, and in preclinical models of wound repair and blood-vessel formation. It is often compared with BPC-157 in tissue-repair literature, though the two have unrelated structures. It is a research compound only.
Further reading: search PubMed for published studies on Thymosin Beta-4.
Storage and handling
Store the vial unopened at -20°C, dry and out of direct light. Bring it to room temperature before opening so moisture does not condense on the solid. Follow your laboratory’s protocols for solvent choice and for storing any prepared solution.
Related products
Thymosin Beta-4 is listed in our Thymic & Immune Peptides range. Related products include Thymosin Beta 4 2mg (TB500), BPC-157 5mg and LL-37 5mg. For reconstitution and sample storage, see our laboratory supplies.
For laboratory research use only. Not for human or veterinary use. Not a medicine, food, supplement or cosmetic.
Reviews
There are no reviews yet.