LL-37 5mg research peptide
LL-37 is the only human cathelicidin antimicrobial peptide. It is the 37-amino-acid C-terminal fragment of the protein hCAP18, named after its first two leucines and its length. This vial contains 5mg.
Specification
| Quantity per vial | 5mg |
|---|---|
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.3 g/mol |
| Stated purity | ≥98% |
| Form | Lyophilised solid |
| Storage | -20°C, sealed, protected from light and moisture |
LL-37 in innate immunity research
LL-37 is amphipathic and helical, and disrupts bacterial membranes in vitro. Beyond its antimicrobial activity, it is studied as a signalling molecule in innate immunity, including chemotaxis, cytokine release and wound-repair models. It is a common reference peptide in microbiology and immunology assays.
Further reading: search PubMed for published studies on LL-37.
Storage and handling
Keep the sealed vial at -20°C away from light and moisture until it is needed, and let it reach room temperature before opening to limit condensation. Your laboratory’s own procedures determine the solvent, concentration and any storage after reconstitution.
Related products
LL-37 is listed in our Thymic & Immune Peptides range. Related products include KPV 10mg, HEP-1 5mg (Gepon) and Thymosin Beta 4 5mg TB500. For reconstitution and sample storage, see our laboratory supplies.
For laboratory research use only. Not for human or veterinary use. Not a medicine, food, supplement or cosmetic.
Reviews
There are no reviews yet.