Thymosin Beta-4 2mg (TB-500)
Thymosin beta-4 (Tβ4) is a 43-amino-acid protein found in most cells, where it is one of the main proteins that bind and sequester G-actin. The research peptide often sold as “TB-500” is listed here with the full 43-residue Tβ4 sequence. This vial contains 2mg.
Specification
| Quantity per vial | 2mg |
|---|---|
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Molecular formula | C212H350N56O78S |
| Molecular weight | 4963.4 g/mol |
| Stated purity | ≥98% |
| Form | Lyophilised solid |
| Storage | -20°C, sealed, protected from light and moisture |
What it is used to study
Because it controls the pool of unpolymerised actin, Tβ4 is studied in cell migration, cytoskeletal dynamics and angiogenesis assays, and in animal models of tissue repair. It is not an approved medicine, and use in competitive sport is prohibited.
Further reading: search PubMed for published studies on Thymosin Beta-4.
Storage and handling
On arrival, transfer the unopened vial to storage at -20°C, protected from light and moisture. Allow it to warm to room temperature before the seal is broken. Reconstitution conditions and the handling of any solution are for the receiving laboratory to set.
Related products
Thymosin Beta-4 is listed in our Thymic & Immune Peptides range. Related products include Thymosin Beta 4 5mg TB500, BPC-157 5mg and KPV 10mg. For reconstitution and sample storage, see our laboratory supplies.
For laboratory research use only. Not for human or veterinary use. Not a medicine, food, supplement or cosmetic.
Reviews
There are no reviews yet.